Lineage for d1iza.1 (1iza B:,A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1239925Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 1239926Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 1239927Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 1239932Protein Insulin [56996] (3 species)
  7. 1240097Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries)
  8. 1240139Domain d1iza.1: 1iza B:,A: [43980]
    mutant

Details for d1iza.1

PDB Entry: 1iza (more details), 2.5 Å

PDB Description: role of b13 glu in insulin assembly: the hexamer structure of recombinant mutant (b13 glu-> gln) insulin
PDB Compounds: (A:) insulin, (B:) insulin

SCOPe Domain Sequences for d1iza.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1iza.1 g.1.1.1 (B:,A:) Insulin {Pig (Sus scrofa) [TaxId: 9823]}
fvnqhlcgshlvqalylvcgergffytpktXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1iza.1:

Click to download the PDB-style file with coordinates for d1iza.1.
(The format of our PDB-style files is described here.)

Timeline for d1iza.1: