Lineage for d1zeid_ (1zei D:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061256Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 1061257Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 1061258Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 1061263Protein Insulin [56996] (3 species)
  7. 1061428Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries)
  8. 1061455Domain d1zeid_: 1zei D: [43966]
    cross-linked b28 asp single-chain design
    complexed with cl, crs, zn

Details for d1zeid_

PDB Entry: 1zei (more details), 1.9 Å

PDB Description: cross-linked b28 asp insulin
PDB Compounds: (D:) insulin

SCOPe Domain Sequences for d1zeid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zeid_ g.1.1.1 (D:) Insulin {Pig (Sus scrofa) [TaxId: 9823]}
fvnqhlcgshlvealylvcgergffytdkaakgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1zeid_:

Click to download the PDB-style file with coordinates for d1zeid_.
(The format of our PDB-style files is described here.)

Timeline for d1zeid_: