Lineage for d1aiy.2 (1aiy D:,C:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 268578Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulphide-rich
  4. 268579Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 268580Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 268585Protein Insulin [56996] (3 species)
  7. 268595Species Human (Homo sapiens) [TaxId:9606] [56998] (53 PDB entries)
  8. 268700Domain d1aiy.2: 1aiy D:,C: [43931]

Details for d1aiy.2

PDB Entry: 1aiy (more details)

PDB Description: r6 human insulin hexamer (symmetric), nmr, 10 structures

SCOP Domain Sequences for d1aiy.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1aiy.2 g.1.1.1 (D:,C:) Insulin {Human (Homo sapiens)}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1aiy.2:

Click to download the PDB-style file with coordinates for d1aiy.2.
(The format of our PDB-style files is described here.)

Timeline for d1aiy.2: