Lineage for d2aiy.5 (2aiy J:,I:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 746752Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 746753Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 746754Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 746759Protein Insulin [56996] (3 species)
  7. 746769Species Human (Homo sapiens) [TaxId:9606] [56998] (60 PDB entries)
  8. 746874Domain d2aiy.5: 2aiy J:,I: [43922]

Details for d2aiy.5

PDB Entry: 2aiy (more details)

PDB Description: r6 human insulin hexamer (symmetric), nmr, 20 structures
PDB Compounds: (I:) protein (insulin), (J:) protein (insulin)

SCOP Domain Sequences for d2aiy.5:

Sequence; same for both SEQRES and ATOM records: (download)

>g2aiy.5 g.1.1.1 (J:,I:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d2aiy.5:

Click to download the PDB-style file with coordinates for d2aiy.5.
(The format of our PDB-style files is described here.)

Timeline for d2aiy.5: