Class g: Small proteins [56992] (85 folds) |
Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
Superfamily g.1.1: Insulin-like [56994] (1 family) |
Family g.1.1.1: Insulin-like [56995] (4 proteins) |
Protein Insulin [56996] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56998] (60 PDB entries) |
Domain d2aiy.4: 2aiy H:,G: [43921] |
PDB Entry: 2aiy (more details)
SCOP Domain Sequences for d2aiy.4:
Sequence; same for both SEQRES and ATOM records: (download)
>g2aiy.4 g.1.1.1 (H:,G:) Insulin {Human (Homo sapiens) [TaxId: 9606]} fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn
Timeline for d2aiy.4: