SCOP 1.59: Domain d3aiy.6: 3aiy L:,K:

Lineage for d3aiy.6 (3aiy L:,K:)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (4 proteins)

6. Protein Insulin [56996] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56998] (50 PDB entries)

8. Domain d3aiy.6: 3aiy L:,K: [43916]

Details for d3aiy.6

PDB Entry: 3aiy

PDB Description: r6 human insulin hexamer (symmetric), nmr, refined average structure

SCOP Domain Sequences for d3aiy.6:

Sequence; same for both SEQRES and ATOM records:

>g3aiy.6 g.1.1.1 (L:,K:) Insulin {Human (Homo sapiens)}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

Timeline for d3aiy.6:

• d3aiy.6 first appeared (with stable ids) in SCOP 1.55
  
• d3aiy.6 appears in SCOP 1.57
  
• d3aiy.6 appears in SCOP 1.61
  
• d3aiy.6 appears in the current release, SCOPe 2.08