SCOP 1.57: Domain d1fu2.4: 1fu2 H:,G:

Lineage for d1fu2.4 (1fu2 H:,G:)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (4 proteins)

6. Protein Insulin [56996] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56998] (47 PDB entries)

8. Domain d1fu2.4: 1fu2 H:,G: [43909]

Details for d1fu2.4

PDB Entry: 1fu2, 3.24 Å

PDB Description: first protein structure determined from x-ray powder diffraction data

SCOP Domain Sequences for d1fu2.4:

Sequence; same for both SEQRES and ATOM records:

>g1fu2.4 g.1.1.1 (H:,G:) Insulin {Human (Homo sapiens)}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

Timeline for d1fu2.4:

• d1fu2.4 first appeared (with stable ids) in SCOP 1.55
  
• d1fu2.4 appears in SCOP 1.59
  
• d1fu2.4 appears in the current release, SCOPe 2.08