Lineage for d1fu2.4 (1fu2 H:,G:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39386Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 39387Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 39388Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 39393Protein Insulin [56996] (3 species)
  7. 39403Species Human (Homo sapiens) [TaxId:9606] [56998] (42 PDB entries)
  8. 39470Domain d1fu2.4: 1fu2 H:,G: [43909]

Details for d1fu2.4

PDB Entry: 1fu2 (more details), 3.24 Å

PDB Description: first protein structure determined from x-ray powder diffraction data

SCOP Domain Sequences for d1fu2.4:

Sequence; same for both SEQRES and ATOM records: (download)

>g1fu2.4 g.1.1.1 (H:,G:) Insulin {Human (Homo sapiens)}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1fu2.4:

Click to download the PDB-style file with coordinates for d1fu2.4.
(The format of our PDB-style files is described here.)

Timeline for d1fu2.4: