Lineage for d4aiy.6 (4aiy L:,K:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1239925Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 1239926Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 1239927Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 1239932Protein Insulin [56996] (3 species)
  7. 1239942Species Human (Homo sapiens) [TaxId:9606] [56998] (60 PDB entries)
    Uniprot P01308
  8. 1240047Domain d4aiy.6: 4aiy L:,K: [43905]
    complexed with iph

Details for d4aiy.6

PDB Entry: 4aiy (more details)

PDB Description: r6 human insulin hexamer (symmetric), nmr, 'green' substate, average structure
PDB Compounds: (K:) protein (insulin), (L:) protein (insulin)

SCOPe Domain Sequences for d4aiy.6:

Sequence; same for both SEQRES and ATOM records: (download)

>g4aiy.6 g.1.1.1 (L:,K:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d4aiy.6:

Click to download the PDB-style file with coordinates for d4aiy.6.
(The format of our PDB-style files is described here.)

Timeline for d4aiy.6: