SCOP 1.59: Domain d1qiz.5: 1qiz J:,I:

Lineage for d1qiz.5 (1qiz J:,I:)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (4 proteins)

6. Protein Insulin [56996] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56998] (50 PDB entries)

8. Domain d1qiz.5: 1qiz J:,I: [43877]

Details for d1qiz.5

PDB Entry: 1qiz, 2 Å

PDB Description: human insulin hexamers with chain b his mutated to tyr complexed with resorcinol

SCOP Domain Sequences for d1qiz.5:

Sequence; same for both SEQRES and ATOM records:

>g1qiz.5 g.1.1.1 (J:,I:) Insulin {Human (Homo sapiens)}
fvnqylcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

Timeline for d1qiz.5:

• d1qiz.5 first appeared (with stable ids) in SCOP 1.55
  
• d1qiz.5 appears in SCOP 1.57
  
• d1qiz.5 appears in SCOP 1.61
  
• d1qiz.5 appears in the current release, SCOPe 2.08