Lineage for d1qiz.3 (1qiz F:,E:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1239925Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 1239926Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 1239927Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 1239932Protein Insulin [56996] (3 species)
  7. 1239942Species Human (Homo sapiens) [TaxId:9606] [56998] (60 PDB entries)
    Uniprot P01308
  8. 1240001Domain d1qiz.3: 1qiz F:,E: [43875]
    complexed with cl, rco, zn

Details for d1qiz.3

PDB Entry: 1qiz (more details), 2 Å

PDB Description: human insulin hexamers with chain b his mutated to tyr complexed with resorcinol
PDB Compounds: (E:) insulin A chain, (F:) insulin B chain

SCOPe Domain Sequences for d1qiz.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g1qiz.3 g.1.1.1 (F:,E:) Insulin {Human (Homo sapiens) [TaxId: 9606]}
fvnqylcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1qiz.3:

Click to download the PDB-style file with coordinates for d1qiz.3.
(The format of our PDB-style files is described here.)

Timeline for d1qiz.3: