SCOP 1.61: Domain d1qiz.1: 1qiz B:,A:

Lineage for d1qiz.1 (1qiz B:,A:)

1. Root: SCOP 1.61

2. Class g: Small proteins [56992] (59 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (4 proteins)

6. Protein Insulin [56996] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56998] (53 PDB entries)

8. Domain d1qiz.1: 1qiz B:,A: [43873]

Details for d1qiz.1

PDB Entry: 1qiz, 2 Å

PDB Description: human insulin hexamers with chain b his mutated to tyr complexed with resorcinol

SCOP Domain Sequences for d1qiz.1:

Sequence; same for both SEQRES and ATOM records:

>g1qiz.1 g.1.1.1 (B:,A:) Insulin {Human (Homo sapiens)}
fvnqylcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

Timeline for d1qiz.1:

• d1qiz.1 first appeared (with stable ids) in SCOP 1.55
  
• d1qiz.1 appears in SCOP 1.59
  
• d1qiz.1 appears in SCOP 1.63
  
• d1qiz.1 appears in the current release, SCOPe 2.08