SCOP 1.59: Domain d1znj.6: 1znj L:,K:

Lineage for d1znj.6 (1znj L:,K:)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (4 proteins)

6. Protein Insulin [56996] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56998] (50 PDB entries)

8. Domain d1znj.6: 1znj L:,K: [43872]

Details for d1znj.6

PDB Entry: 1znj, 2 Å

PDB Description: insulin, monoclinic crystal form

SCOP Domain Sequences for d1znj.6:

Sequence; same for both SEQRES and ATOM records:

>g1znj.6 g.1.1.1 (L:,K:) Insulin {Human (Homo sapiens)}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

Timeline for d1znj.6:

• d1znj.6 first appeared (with stable ids) in SCOP 1.55
  
• d1znj.6 appears in SCOP 1.57
  
• d1znj.6 appears in SCOP 1.61
  
• d1znj.6 appears in the current release, SCOPe 2.08