Lineage for d7ahlg_ (7ahl G:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1696348Fold f.6: Leukocidin-like [56958] (1 superfamily)
    subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel
  4. 1696349Superfamily f.6.1: Leukocidin-like [56959] (3 families) (S)
  5. 1696350Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
    heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit
    automatically mapped to Pfam PF07968
  6. 1696351Protein Alpha-hemolysin [56961] (2 species)
  7. 1696352Species Staphylococcus aureus [TaxId:1280] [56962] (5 PDB entries)
  8. 1696359Domain d7ahlg_: 7ahl G: [43818]

Details for d7ahlg_

PDB Entry: 7ahl (more details), 1.89 Å

PDB Description: alpha-hemolysin from staphylococcus aureus
PDB Compounds: (G:) alpha-hemolysin

SCOPe Domain Sequences for d7ahlg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ahlg_ f.6.1.1 (G:) Alpha-hemolysin {Staphylococcus aureus [TaxId: 1280]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

SCOPe Domain Coordinates for d7ahlg_:

Click to download the PDB-style file with coordinates for d7ahlg_.
(The format of our PDB-style files is described here.)

Timeline for d7ahlg_: