Lineage for d7ahlg_ (7ahl G:)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 202223Fold f.6: Leukocidin (pore-forming toxin) [56958] (1 superfamily)
  4. 202224Superfamily f.6.1: Leukocidin (pore-forming toxin) [56959] (1 family) (S)
  5. 202225Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (3 proteins)
  6. 202226Protein Alpha-hemolysin [56961] (1 species)
  7. 202227Species Staphylococcus aureus [TaxId:1280] [56962] (1 PDB entry)
  8. 202234Domain d7ahlg_: 7ahl G: [43818]

Details for d7ahlg_

PDB Entry: 7ahl (more details), 1.9 Å

PDB Description: alpha-hemolysin from staphylococcus aureus

SCOP Domain Sequences for d7ahlg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ahlg_ f.6.1.1 (G:) Alpha-hemolysin {Staphylococcus aureus}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

SCOP Domain Coordinates for d7ahlg_:

Click to download the PDB-style file with coordinates for d7ahlg_.
(The format of our PDB-style files is described here.)

Timeline for d7ahlg_: