SCOPe 2.01: Domain d7ahle_: 7ahl E:

Lineage for d7ahle_ (7ahl E:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.6: Leukocidin-like [56958] (1 superfamily)
   subunit fold contains beta-sandwich of Ig-like (grerk-key) topology and a beta-ribbon arm that forms an oligomeric transmembrane barrel

4. Superfamily f.6.1: Leukocidin-like [56959] (2 families)

5. Family f.6.1.1: Leukocidin (pore-forming toxin) [56960] (5 proteins)
   heptameric fold contains barrel (n=14, S=14) formed by beta-ribbon arms, one from each subunit

6. Protein Alpha-hemolysin [56961] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [56962] (5 PDB entries)

8. Domain d7ahle_: 7ahl E: [43816]

Details for d7ahle_

PDB Entry: 7ahl, 1.89 Å

PDB Description: alpha-hemolysin from staphylococcus aureus

PDB Compounds: (E:) alpha-hemolysin

SCOPe Domain Sequences for d7ahle_:

Sequence; same for both SEQRES and ATOM records:

>d7ahle_ f.6.1.1 (E:) Alpha-hemolysin {Staphylococcus aureus [TaxId: 1280]}
adsdiniktgttdigsnttvktgdlvtydkengmhkkvfysfiddknhnkkllvirtkgt
iagqyrvyseeganksglawpsafkvqlqlpdnevaqisdyyprnsidtkeymstltygf
ngnvtgddtgkiggliganvsightlkyvqpdfktilesptdkkvgwkvifnnmvnqnwg
pydrdswnpvygnqlfmktrngsmkaadnfldpnkassllssgfspdfatvitmdrkask
qqtnidviyervrddyqlhwtstnwkgtntkdkwtdrsserykidwekeemtn

Timeline for d7ahle_:

• d7ahle_ first appeared (with stable ids) in SCOP 1.55
  
• d7ahle_ appears in SCOP 1.75
  
• d7ahle_ appears in SCOPe 2.02
  
• d7ahle_ appears in the current release, SCOPe 2.08