Lineage for d8prna_ (8prn A:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1058226Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 1058287Superfamily f.4.3: Porins [56935] (4 families) (S)
  5. 1058288Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 1058289Protein Porin [56937] (5 species)
  7. 1058321Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries)
  8. 1058328Domain d8prna_: 8prn A: [43767]
    complexed with c8e; mutant

Details for d8prna_

PDB Entry: 8prn (more details), 2.3 Å

PDB Description: e1m, k50a, r52a, d97a, e99a mutant of rh. blastica porin
PDB Compounds: (A:) porin

SCOPe Domain Sequences for d8prna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8prna_ f.4.3.1 (A:) Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]}
mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaalamqwddgda
fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltyasamgyeassfgdaqssffaynsk
ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf

SCOPe Domain Coordinates for d8prna_:

Click to download the PDB-style file with coordinates for d8prna_.
(The format of our PDB-style files is described here.)

Timeline for d8prna_: