Lineage for d6prn__ (6prn -)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 267556Fold f.4: Transmembrane beta-barrels [56924] (4 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 267586Superfamily f.4.3: Porins [56935] (3 families) (S)
  5. 267587Family f.4.3.1: Porin [56936] (1 protein)
    trimer, one subunit folds into (16,20) barrel
  6. 267588Protein Porin [56937] (5 species)
  7. 267612Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (9 PDB entries)
  8. 267617Domain d6prn__: 6prn - [43765]
    complexed with c8e; mutant

Details for d6prn__

PDB Entry: 6prn (more details), 2.04 Å

PDB Description: e1m, k50a, r52a mutant of rh. blastica porin

SCOP Domain Sequences for d6prn__:

Sequence; same for both SEQRES and ATOM records: (download)

>d6prn__ f.4.3.1 (-) Porin {Rhodopseudomonas blastica, strain DSM2131}
mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaalamqwddgda
fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydsemgyeassfgdaqssffaynsk
ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf

SCOP Domain Coordinates for d6prn__:

Click to download the PDB-style file with coordinates for d6prn__.
(The format of our PDB-style files is described here.)

Timeline for d6prn__: