Lineage for d5prn__ (5prn -)
- Root: SCOP 1.61
Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) 
Fold f.4: Transmembrane beta-barrels [56924] (4 superfamilies) 
Superfamily f.4.3: Porins [56935] (3 families) 
Family f.4.3.1: Porin [56936] (1 protein) Protein Porin [56937] (5 species) 
Species Rhodopseudomonas blastica, strain DSM2131 [TaxId:1075] [56940] (8 PDB entries) 
Domain d5prn__: 5prn - [43764]
Details for d5prn__
PDB Entry: 5prn (more details), 2 Å
PDB Description: e1m, y96w, s119w mutant of rh. blastica porin
SCOP Domain Sequences for d5prn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d5prn__ f.4.3.1 (-) Porin {Rhodopseudomonas blastica, strain DSM2131}
mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltwdsemgyeassfgdaqssffaynwk
ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf
SCOP Domain Coordinates for d5prn__:
Click to download the PDB-style file with coordinates for d5prn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5prn__:
- d5prn__ first appeared (with stable ids) in SCOP 1.55
- d5prn__ appears in SCOP 1.59
- d5prn__ appears in SCOP 1.63
- d5prn__ appears in the current release, SCOPe 2.08, called d5prna_
View in 3D