Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) |
Superfamily f.4.3: Porins [56935] (4 families) |
Family f.4.3.1: Porin [56936] (2 proteins) trimer, one subunit folds into (16,20) barrel |
Protein Porin [56937] (5 species) |
Species Rhodobacter capsulatus [TaxId:1061] [56939] (2 PDB entries) |
Domain d3pora_: 3por A: [43760] complexed with c8e, trs |
PDB Entry: 3por (more details), 2.5 Å
SCOPe Domain Sequences for d3pora_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pora_ f.4.3.1 (A:) Porin {Rhodobacter capsulatus [TaxId: 1061]} evklsgdarmgvmyngddwnfssrsrvlftmsgttdsglefgasfkahesvgaetgedgt vflsgafgkiemgdalgasealfgdlyevgytdlddrggndipyltgderltaednpvll ytysagafsvaasmsdgkvgetseddaqemavaaaytfgnytvglgyekidspdtalmad meqlelaaiakfgatnvkayyadgeldrdfaravfdltpvaaaatavdhkayglsvdstf gattvggyvqvldidtiddvtyyglgasydlgggasivggiadndlpnsdmvadlgvkfk f
Timeline for d3pora_: