Lineage for d1gfo__ (1gfo -)
- Root: SCOP 1.59
Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) 
Fold f.4: Transmembrane beta-barrels [56924] (4 superfamilies) 
Superfamily f.4.3: Porins [56935] (3 families) 
Family f.4.3.1: Porin [56936] (1 protein) Protein Porin [56937] (5 species) 
Species Escherichia coli, different sequences [TaxId:562] [56938] (13 PDB entries) 
Domain d1gfo__: 1gfo - [43753]
Details for d1gfo__
PDB Entry: 1gfo (more details), 3.3 Å
PDB Description: ompf porin (mutant r132p)
SCOP Domain Sequences for d1gfo__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gfo__ f.4.3.1 (-) Porin {Escherichia coli, different sequences}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefgg
dtaysddffvgpvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf
SCOP Domain Coordinates for d1gfo__:
Click to download the PDB-style file with coordinates for d1gfo__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gfo__:
- d1gfo__ first appeared (with stable ids) in SCOP 1.55
- d1gfo__ appears in SCOP 1.57
- d1gfo__ appears in SCOP 1.61
- d1gfo__ appears in the current release, SCOPe 2.08, called d1gfoa_
View in 3D