SCOPe 2.04: Domain d1mpfa_: 1mpf A:

Lineage for d1mpfa_ (1mpf A:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.3: Porins [56935] (4 families)

5. Family f.4.3.1: Porin [56936] (2 proteins)
   trimer, one subunit folds into (16,20) barrel

6. Protein Porin [56937] (5 species)

7. Species Escherichia coli, different sequences [TaxId:562] [56938] (27 PDB entries)

8. Domain d1mpfa_: 1mpf A: [43752]
   complexed with c8e; mutant

Details for d1mpfa_

PDB Entry: 1mpf, 3 Å

PDB Description: structural and functional alterations of a colicin resistant mutant of ompf-porin from escherichia coli

PDB Compounds: (A:) matrix porin outer membrane protein f

SCOPe Domain Sequences for d1mpfa_:

Sequence; same for both SEQRES and ATOM records:

>d1mpfa_ f.4.3.1 (A:) Porin {Escherichia coli, different sequences [TaxId: 562]}
aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygq
weynfqgnnsegadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefdg
dtaysddffvgrvggvatyrnsnffglvdglnfavqylgknerdtarrsngdgvggsisy
eyegfgivgaygaadrtnlqeaqplgngkkaeqwatglkydanniylaanygetrnatpi
tnkftntsgfanktqdvllvaqyqfdfglrpsiaytkskakdvegigdvdlvnyfevgat
yyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf

Timeline for d1mpfa_:

• d1mpfa_ first appeared (with stable ids) in SCOP 1.55, called d1mpf__
  
• d1mpfa_ appears in SCOPe 2.03
  
• d1mpfa_ appears in SCOPe 2.05
  
• d1mpfa_ appears in the current release, SCOPe 2.08