![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
![]() | Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (2 proteins) duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry |
![]() | Protein Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56911] (1 species) |
![]() | Species Wolinella succinogenes [TaxId:844] [56913] (5 PDB entries) |
![]() | Domain d1qlbf_: 1qlb F: [43725] Other proteins in same PDB: d1qlba1, d1qlba2, d1qlba3, d1qlbb1, d1qlbb2, d1qlbd1, d1qlbd2, d1qlbd3, d1qlbe1, d1qlbe2 complexed with ca, f3s, fad, fes, fum, hem, lmt, sf4 |
PDB Entry: 1qlb (more details), 2.33 Å
SCOPe Domain Sequences for d1qlbf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlbf_ f.21.2.1 (F:) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]} mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd pnidykyfdykrth
Timeline for d1qlbf_: