Lineage for d3bcce2 (3bcc E:1-69)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519895Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 520129Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) (S)
  5. 520130Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 520131Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 520138Species Chicken (Gallus gallus) [TaxId:9031] [81498] (3 PDB entries)
  8. 520141Domain d3bcce2: 3bcc E:1-69 [43713]
    Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bccf_, d3bccg_, d3bcch_, d3bccj_

Details for d3bcce2

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d3bcce2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bcce2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Chicken (Gallus gallus)}
shtdikvpnfsdyrrppddystkssresdpsrkgfsylvtavttlgvayaaknvvtqfvs
smsasadvl

SCOP Domain Coordinates for d3bcce2:

Click to download the PDB-style file with coordinates for d3bcce2.
(The format of our PDB-style files is described here.)

Timeline for d3bcce2: