Details for d3bccd3

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken

SCOP Domain Sequences for d3bccd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bccd3 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Chicken (Gallus gallus)}
pehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrppk

SCOP Domain Coordinates for d3bccd3:

Click to download the PDB-style file with coordinates for d3bccd3.
(The format of our PDB-style files is described here.)

Timeline for d3bccd3: