SCOP 1.65: Domain d1bl8d_: 1bl8 D:

Lineage for d1bl8d_ (1bl8 D:)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (4 proteins)

6. Protein Potassium channel protein [56901] (1 species)

7. Species Streptomyces lividans [TaxId:1916] [56902] (8 PDB entries)

8. Domain d1bl8d_: 1bl8 D: [43655]
   residues 1-125
   complexed with k; mutant

Details for d1bl8d_

PDB Entry: 1bl8, 3.2 Å

PDB Description: potassium channel (kcsa) from streptomyces lividans

SCOP Domain Sequences for d1bl8d_:

Sequence; same for both SEQRES and ATOM records:

>d1bl8d_ f.14.1.1 (D:) Potassium channel protein {Streptomyces lividans}
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq

Timeline for d1bl8d_:

• d1bl8d_ first appeared (with stable ids) in SCOP 1.55
  
• d1bl8d_ appears in SCOP 1.63
  
• d1bl8d_ appears in SCOP 1.67
  
• d1bl8d_ appears in the current release, SCOPe 2.08