Lineage for d1bl8d_ (1bl8 D:)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87593Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 87594Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 88003Family f.2.1.11: Oligomeric gated channels [63383] (3 proteins)
  6. 88011Protein Potassium chanel protein [56901] (1 species)
  7. 88012Species Streptomyces lividans [TaxId:1916] [56902] (3 PDB entries)
  8. 88020Domain d1bl8d_: 1bl8 D: [43655]

Details for d1bl8d_

PDB Entry: 1bl8 (more details), 3.2 Å

PDB Description: potassium channel (kcsa) from streptomyces lividans

SCOP Domain Sequences for d1bl8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bl8d_ f.2.1.11 (D:) Potassium chanel protein {Streptomyces lividans}
alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly
pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq

SCOP Domain Coordinates for d1bl8d_:

Click to download the PDB-style file with coordinates for d1bl8d_.
(The format of our PDB-style files is described here.)

Timeline for d1bl8d_: