Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (10 families) |
Family f.2.1.11: Oligomeric gated channels [63383] (3 proteins) |
Protein Potassium chanel protein [56901] (1 species) |
Species Streptomyces lividans [TaxId:1916] [56902] (3 PDB entries) |
Domain d1bl8d_: 1bl8 D: [43655] |
PDB Entry: 1bl8 (more details), 3.2 Å
SCOP Domain Sequences for d1bl8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bl8d_ f.2.1.11 (D:) Potassium chanel protein {Streptomyces lividans} alhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdly pvtlwgrcvavvvmvagitsfglvtaalatwfvgreq
Timeline for d1bl8d_: