SCOP 1.63: Domain d1fx8a_: 1fx8 A:

Lineage for d1fx8a_ (1fx8 A:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.19: Aquaporin-like [81339] (1 superfamily)
   core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices

4. Superfamily f.19.1: Aquaporin-like [81338] (1 family)

5. Family f.19.1.1: Aquaporin-like [56895] (2 proteins)
   duplication: consist of two similar structural parts

6. Protein Glycerol uptake facilitator protein GlpF [56898] (1 species)
   glycerol conducting channel, related to aquaporin

7. Species Escherichia coli [TaxId:562] [56899] (4 PDB entries)

8. Domain d1fx8a_: 1fx8 A: [43651]
   complexed with bog, cry

Details for d1fx8a_

PDB Entry: 1fx8, 2.2 Å

PDB Description: crystal structure of the e. coli glycerol facilitator (glpf) with substrate glycerol

SCOP Domain Sequences for d1fx8a_:

Sequence; same for both SEQRES and ATOM records:

>d1fx8a_ f.19.1.1 (A:) Glycerol uptake facilitator protein GlpF {Escherichia coli}
tlkgqciaeflgtglliffgvgcvaalkvagasfgqweisviwglgvamaiyltagvsga
hlnpavtialwlfacfdkrkvipfivsqvagafcaaalvyglyynlffdfeqthhivrgs
vesvdlagtfstypnphinfvqafavemvitailmglilaltddgngvprgplaplligl
liavigasmgpltgfamnpardfgpkvfawlagwgnvaftggrdipyflvplfgpivgai
vgafayrkligrhl

Timeline for d1fx8a_:

• d1fx8a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fx8a_ appears in SCOP 1.61
  
• d1fx8a_ appears in SCOP 1.65
  
• d1fx8a_ appears in the current release, SCOPe 2.08