Lineage for d1c17i_ (1c17 I:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629298Superfamily f.17.1: Rotary ATPase ring subunits [81333] (2 families) (S)
    automatically mapped to Pfam PF00137
  5. 2629299Family f.17.1.1: F1F0 ATP synthase subunit C or V-type proton ATPase subunit c [81332] (3 proteins)
  6. 2629300Protein F1F0 ATP synthase subunit C [56891] (1 species)
  7. 2629301Species Escherichia coli [TaxId:562] [56892] (6 PDB entries)
  8. 2629312Domain d1c17i_: 1c17 I: [43644]
    Other proteins in same PDB: d1c17m_

Details for d1c17i_

PDB Entry: 1c17 (more details)

PDB Description: a1c12 subcomplex of f1fo atp synthase
PDB Compounds: (I:) ATP synthase subunit c

SCOPe Domain Sequences for d1c17i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c17i_ f.17.1.1 (I:) F1F0 ATP synthase subunit C {Escherichia coli [TaxId: 562]}
menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
daipmiavglglyvmfava

SCOPe Domain Coordinates for d1c17i_:

Click to download the PDB-style file with coordinates for d1c17i_.
(The format of our PDB-style files is described here.)

Timeline for d1c17i_: