Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.1: Rotary ATPase ring subunits [81333] (2 families) automatically mapped to Pfam PF00137 |
Family f.17.1.1: F1F0 ATP synthase subunit C or V-type proton ATPase subunit c [81332] (3 proteins) |
Protein F1F0 ATP synthase subunit C [56891] (1 species) |
Species Escherichia coli [TaxId:562] [56892] (6 PDB entries) |
Domain d1c99a_: 1c99 A: [43633] |
PDB Entry: 1c99 (more details)
SCOPe Domain Sequences for d1c99a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c99a_ f.17.1.1 (A:) F1F0 ATP synthase subunit C {Escherichia coli [TaxId: 562]} menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv daipmiavglglyvmfava
Timeline for d1c99a_: