Lineage for d1oczb2 (1ocz B:1-90)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 141921Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)
  6. 141922Protein Cytochrome c oxidase [56884] (3 species)
  7. 141923Species Cow (Bos taurus) [TaxId:9913] [56885] (5 PDB entries)
  8. 141985Domain d1oczb2: 1ocz B:1-90 [43579]
    Other proteins in same PDB: d1oczb1, d1ocze_, d1oczf_, d1oczh_, d1oczo1, d1oczr_, d1oczs_, d1oczu_

Details for d1oczb2

PDB Entry: 1ocz (more details), 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state

SCOP Domain Sequences for d1oczb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oczb2 f.2.1.3 (B:1-90) Cytochrome c oxidase {Cow (Bos taurus)}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOP Domain Coordinates for d1oczb2:

Click to download the PDB-style file with coordinates for d1oczb2.
(The format of our PDB-style files is described here.)

Timeline for d1oczb2: