Lineage for d2occj_ (2occ J:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887225Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
  5. 887226Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (1 protein)
  6. 887227Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 887228Species Cow (Bos taurus) [TaxId:9913] [81416] (14 PDB entries)
  8. 887243Domain d2occj_: 2occ J: [43524]
    Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occh_, d2occi_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occx_, d2occy_, d2occz_

Details for d2occj_

PDB Entry: 2occ (more details), 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (J:) cytochrome c oxidase

SCOP Domain Sequences for d2occj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2occj_ f.23.4.1 (J:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

SCOP Domain Coordinates for d2occj_:

Click to download the PDB-style file with coordinates for d2occj_.
(The format of our PDB-style files is described here.)

Timeline for d2occj_: