| Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
| Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) ![]() |
| Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins) |
| Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [81454] (14 PDB entries) |
| Domain d2occb2: 2occ B:1-90 [43519] Other proteins in same PDB: d2occa_, d2occb1, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occh_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_ |
PDB Entry: 2occ (more details), 2.3 Å
SCOP Domain Sequences for d2occb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2occb2 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei
Timeline for d2occb2:
View in 3DDomains from other chains: (mouse over for more information) d2occa_, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occh_, d2occi_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occu_, d2occv_, d2occw_, d2occx_, d2occy_, d2occz_ |