Lineage for d2occi_ (2occ I:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238077Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) (S)
  5. 1238078Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)
  6. 1238079Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 1238080Species Cow (Bos taurus) [TaxId:9913] [81412] (24 PDB entries)
  8. 1238112Domain d2occi_: 2occ I: [43523]
    Other proteins in same PDB: d2occa_, d2occb1, d2occb2, d2occc_, d2occd_, d2occe_, d2occf_, d2occg_, d2occh_, d2occj_, d2occk_, d2occl_, d2occm_, d2occn_, d2occo1, d2occo2, d2occp_, d2occq_, d2occr_, d2occs_, d2occt_, d2occu_, d2occw_, d2occx_, d2occy_, d2occz_
    complexed with cu, hea, mg, na, per, zn

Details for d2occi_

PDB Entry: 2occ (more details), 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (I:) cytochrome c oxidase

SCOPe Domain Sequences for d2occi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2occi_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

SCOPe Domain Coordinates for d2occi_:

Click to download the PDB-style file with coordinates for d2occi_.
(The format of our PDB-style files is described here.)

Timeline for d2occi_: