SCOPe 2.08: Domain d4rcrl_: 4rcr L:

Lineage for d4rcrl_ (4rcr L:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (68 PDB entries)
   Uniprot P02954

8. Domain d4rcrl_: 4rcr L: [43512]
   Other proteins in same PDB: d4rcrh1, d4rcrh2, d4rcrm_
   complexed with bcl, bog, bph, fe, u10

Details for d4rcrl_

PDB Entry: 4rcr, 2.8 Å

PDB Description: structure of the reaction center from rhodobacter sphaeroides r-26 and 2.4.1: protein-cofactor (bacteriochlorophyll, bacteriopheophytin, and carotenoid) interactions

PDB Compounds: (L:) photosynthetic reaction center

SCOPe Domain Sequences for d4rcrl_:

Sequence; same for both SEQRES and ATOM records:

>d4rcrl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
ferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwnpqli
svyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfafafa
ilayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisffftna
lalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsavffs
alcmiitgtiwfdqwvdwwqwwvklp

Timeline for d4rcrl_:

• d4rcrl_ first appeared (with stable ids) in SCOP 1.55, called d4rcrl1
  
• d4rcrl_ appears in SCOPe 2.07