Lineage for d2rcrl_ (2rcr L:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1060394Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1060395Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 1060396Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1060397Protein L (light) subunit [81477] (3 species)
  7. 1060398Species Rhodobacter sphaeroides [TaxId:1063] [81475] (45 PDB entries)
    Uniprot P02954
  8. 1060448Domain d2rcrl_: 2rcr L: [43506]
    Other proteins in same PDB: d2rcrh1, d2rcrh2, d2rcrm_
    complexed with bcl, bph, fe, uq

Details for d2rcrl_

PDB Entry: 2rcr (more details), 3.1 Å

PDB Description: structure of the membrane-bound protein photosynthetic reaction center from rhodobacter sphaeroides
PDB Compounds: (L:) photosynthetic reaction center (l subunit)

SCOPe Domain Sequences for d2rcrl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcrl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgg

SCOPe Domain Coordinates for d2rcrl_:

Click to download the PDB-style file with coordinates for d2rcrl_.
(The format of our PDB-style files is described here.)

Timeline for d2rcrl_: