Lineage for d1dv6l_ (1dv6 L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027283Protein L (light) subunit [81477] (4 species)
  7. 3027284Species Rhodobacter sphaeroides [TaxId:1063] [81475] (68 PDB entries)
    Uniprot P02954
  8. 3027302Domain d1dv6l_: 1dv6 L: [43488]
    Other proteins in same PDB: d1dv6h1, d1dv6h2, d1dv6m_, d1dv6s_, d1dv6t1, d1dv6t2
    complexed with bcl, bph, cl, fe2, lda, u10, zn

Details for d1dv6l_

PDB Entry: 1dv6 (more details), 2.5 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the charge-neutral dqaqb state with the proton transfer inhibitor zn2+
PDB Compounds: (L:) photosynthetic reaction center

SCOPe Domain Sequences for d1dv6l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv6l_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d1dv6l_:

Click to download the PDB-style file with coordinates for d1dv6l_.
(The format of our PDB-style files is described here.)

Timeline for d1dv6l_: