Lineage for d1aign_ (1aig N:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027283Protein L (light) subunit [81477] (4 species)
  7. 3027284Species Rhodobacter sphaeroides [TaxId:1063] [81475] (68 PDB entries)
    Uniprot P02954
  8. 3027307Domain d1aign_: 1aig N: [43485]
    Other proteins in same PDB: d1aigh1, d1aigh2, d1aigm_, d1aigo_, d1aigp1, d1aigp2
    complexed with bcl, bph, fe2, u10

Details for d1aign_

PDB Entry: 1aig (more details), 2.6 Å

PDB Description: photosynthetic reaction center from rhodobacter sphaeroides in the d+qb-charge separated state
PDB Compounds: (N:) photosynthetic reaction center (l subunit)

SCOPe Domain Sequences for d1aign_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aign_ f.26.1.1 (N:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOPe Domain Coordinates for d1aign_:

Click to download the PDB-style file with coordinates for d1aign_.
(The format of our PDB-style files is described here.)

Timeline for d1aign_: