SCOPe 2.02: Domain d1mpsl_: 1mps L:

Lineage for d1mpsl_ (1mps L:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (54 PDB entries)
   Uniprot P02954

8. Domain d1mpsl_: 1mps L: [43467]
   Other proteins in same PDB: d1mpsh1, d1mpsh2, d1mpsm_
   complexed with bcl, bph, fe2, lda, po4, spn, u10; mutant

Details for d1mpsl_

PDB Entry: 1mps, 2.55 Å

PDB Description: photosynthetic reaction center mutant with phe m 197 replaced with arg and tyr m 177 replaced with phe (chain m, y177f, f197r)

PDB Compounds: (L:) photosynthetic reaction center

SCOPe Domain Sequences for d1mpsl_:

Sequence; same for both SEQRES and ATOM records:

>d1mpsl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1mpsl_:

• d1mpsl_ first appeared (with stable ids) in SCOP 1.55, called d1mpsl1
  
• d1mpsl_ appears in SCOPe 2.01
  
• d1mpsl_ appears in SCOPe 2.03
  
• d1mpsl_ appears in the current release, SCOPe 2.08