Lineage for d6prch2 (6prc H:1-36)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238365Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family) (S)
  5. 1238366Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 1238367Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)
  7. 1238416Species Rhodopseudomonas viridis [TaxId:1079] [81485] (11 PDB entries)
    synonym: blastochloris viridis
  8. 1238419Domain d6prch2: 6prc H:1-36 [43436]
    Other proteins in same PDB: d6prcc_, d6prch1, d6prcl_, d6prcm_
    complexed with bcb, bpb, ceb, fe2, hem, lda, mq7, ns5, so4

Details for d6prch2

PDB Entry: 6prc (more details), 2.3 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420314 (triazine) complex)
PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d6prch2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6prch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOPe Domain Coordinates for d6prch2:

Click to download the PDB-style file with coordinates for d6prch2.
(The format of our PDB-style files is described here.)

Timeline for d6prch2: