Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family) |
Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein) |
Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species) |
Species Rhodopseudomonas viridis [TaxId:1079] [81485] (11 PDB entries) synonym: blastochloris viridis |
Domain d6prch2: 6prc H:1-36 [43436] Other proteins in same PDB: d6prcc_, d6prch1, d6prcl_, d6prcm_ complexed with bcb, bpb, ceb, fe2, hem, lda, mq7, ns5, so4 |
PDB Entry: 6prc (more details), 2.3 Å
SCOPe Domain Sequences for d6prch2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6prch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]} myhgalaqhldiaqlvwyaqwlviwtvvllylrred
Timeline for d6prch2: