SCOP 1.73: Domain d1fbba_: 1fbb A:

Lineage for d1fbba_ (1fbb A:)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families)

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (5 proteins)

6. Protein Bacteriorhodopsin [56871] (2 species)
   a light-driven proton pump

7. Species Archaeon Halobacterium salinarum [TaxId:2242] [56873] (60 PDB entries)

8. Domain d1fbba_: 1fbb A: [43425]
   complexed with ret

Details for d1fbba_

PDB Entry: 1fbb, 3.2 Å

PDB Description: crystal structure of native conformation of bacteriorhodopsin

PDB Compounds: (A:) bacteriorhodopsin

SCOP Domain Sequences for d1fbba_:

Sequence; same for both SEQRES and ATOM records:

>d1fbba_ f.13.1.1 (A:) Bacteriorhodopsin {Archaeon Halobacterium salinarum [TaxId: 2242]}
itgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllg
ygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtgl
vgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlws
aypvvwligsegagivplnietllfmvldvsakvgfglillrsr

Timeline for d1fbba_:

• d1fbba_ first appeared (with stable ids) in SCOP 1.55
  
• d1fbba_ appears in SCOP 1.71
  
• d1fbba_ appears in SCOP 1.75
  
• d1fbba_ appears in the current release, SCOPe 2.08