Lineage for d1lxl__ (1lxl -)
- Root: SCOP 1.57
Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) 
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) 
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) 
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (4 proteins) Protein Apoptosis regulator Bcl-xL [56856] (2 species) Species Human (Homo sapiens) [TaxId:9606] [56857] (4 PDB entries) 
Domain d1lxl__: 1lxl - [43395]
Details for d1lxl__
PDB Entry: 1lxl (more details)
PDB Description: nmr structure of bcl-xl, an inhibitor of programmed cell death, minimized average structure
SCOP Domain Sequences for d1lxl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lxl__ f.1.4.1 (-) Apoptosis regulator Bcl-xL {Human (Homo sapiens)}
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnps
whladspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhhh
SCOP Domain Coordinates for d1lxl__:
Click to download the PDB-style file with coordinates for d1lxl__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lxl__:
- d1lxl__ first appeared (with stable ids) in SCOP 1.55
- d1lxl__ appears in SCOP 1.59
- d1lxl__ appears in the current release, SCOPe 2.08, called d1lxla1
View in 3D