Lineage for d1lxla1 (1lxl A:-3-209)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575217Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2575295Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2575296Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2575302Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 2575303Species Human (Homo sapiens) [TaxId:9606] [56857] (36 PDB entries)
  8. 2575357Domain d1lxla1: 1lxl A:-3-209 [43395]
    Other proteins in same PDB: d1lxla2

Details for d1lxla1

PDB Entry: 1lxl (more details)

PDB Description: nmr structure of bcl-xl, an inhibitor of programmed cell death, minimized average structure
PDB Compounds: (A:) bcl-xl

SCOPe Domain Sequences for d1lxla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lxla1 f.1.4.1 (A:-3-209) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnps
whladspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygnnaaaesrkgqer

SCOPe Domain Coordinates for d1lxla1:

Click to download the PDB-style file with coordinates for d1lxla1.
(The format of our PDB-style files is described here.)

Timeline for d1lxla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lxla2