![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families) ![]() automatically mapped to Pfam PF02764 |
![]() | Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein) |
![]() | Protein Diphtheria toxin, middle domain [56847] (1 species) contains globin-like fold with two additional helices at N-termini but has no counterpart to the first globin helix (A) |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [56848] (7 PDB entries) |
![]() | Domain d1mdtb3: 1mdt B:200-380 [43387] Other proteins in same PDB: d1mdta1, d1mdta2, d1mdtb1, d1mdtb2 complexed with apu |
PDB Entry: 1mdt (more details), 2.3 Å
SCOPe Domain Sequences for d1mdtb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mdtb3 f.1.2.1 (B:200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]} scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa y
Timeline for d1mdtb3: