Lineage for d1cjsa_ (1cjs A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1954161Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
    2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)
  4. 1954162Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) (S)
    automatically mapped to Pfam PF00687
  5. 1954163Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)
  6. 1954164Protein Ribosomal protein L1 [56810] (4 species)
  7. 1954165Species Methanococcus jannaschii [TaxId:2190] [56812] (3 PDB entries)
  8. 1954167Domain d1cjsa_: 1cjs A: [43354]

Details for d1cjsa_

PDB Entry: 1cjs (more details), 2.3 Å

PDB Description: crystal structure of ribosomal protein l1 from methanococcus jannaschii
PDB Compounds: (A:) 50s ribosomal protein l1p

SCOPe Domain Sequences for d1cjsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjsa_ e.24.1.1 (A:) Ribosomal protein L1 {Methanococcus jannaschii [TaxId: 2190]}
mdreallqavkearelakprnftqsfefiatlkeidmrkpenriktevvlphgrgkeaki
avigtgdlakqaeelgltvirkeeieelgknkrklrkiakahdffiaqadlmpligrymg
vilgprgkmpkpvpananikplverlkktvvintrdkpyfqvlvgnekmtdeqivdniea
vlnvvakkyekglyhikdayvkltmgpavkvkk

SCOPe Domain Coordinates for d1cjsa_:

Click to download the PDB-style file with coordinates for d1cjsa_.
(The format of our PDB-style files is described here.)

Timeline for d1cjsa_: