SCOP 1.67: Domain d1qq6a_: 1qq6 A:

Lineage for d1qq6a_ (1qq6 A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (14 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.1: L-2-Haloacid dehalogenase, HAD [56785] (1 protein)
   the insertion subdomain is a 4-helical bundle

6. Protein L-2-Haloacid dehalogenase, HAD [56786] (2 species)

7. Species Xanthobacter autotrophicus [56788] (4 PDB entries)

8. Domain d1qq6a_: 1qq6 A: [43333]

Details for d1qq6a_

PDB Entry: 1qq6, 2.1 Å

PDB Description: structure of l-2-haloacid dehalogenase from xanthobacter autotrophicus with chloroacetic acid covalently bound

SCOP Domain Sequences for d1qq6a_:

Sequence; same for both SEQRES and ATOM records:

>d1qq6a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus}
mikavvfdaygtlfdvqsvadateraypgrgeyitqvwrqkqleyswlralmgryadfws
vtrealaytlgtlglepdesfladmaqaynrltpypdaaqclaelaplkrailsngapdm
lqalvanagltdsfdavisvdakrvfkphpdsyalveevlgvtpaevlfvssngfdvgga
knfgfsvarvarlsqealarelvsgtiapltmfkalrmreetyaeapdfvvpalgdlprl
vrgma

Timeline for d1qq6a_:

• d1qq6a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qq6a_ appears in SCOP 1.65
  
• d1qq6a_ appears in SCOP 1.69
  
• d1qq6a_ appears in the current release, SCOPe 2.08