Lineage for d7hsca_ (7hsc A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383472Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 383473Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 383474Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (1 protein)
  6. 383475Protein DnaK [100922] (2 species)
  7. 383485Species Rat (Rattus norvegicus) [TaxId:10116] [56782] (2 PDB entries)
  8. 383487Domain d7hsca_: 7hsc A: [43322]

Details for d7hsca_

PDB Entry: 7hsc (more details)

PDB Description: high resolution solution structure of the heat shock cognate-70 kd substrate binding domain obtained by multidimensional nmr techniques

SCOP Domain Sequences for d7hsca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7hsca_ b.130.1.1 (A:) DnaK {Rat (Rattus norvegicus)}
senvqdlllldvtplslgietaggvmtvlikrnttiptkqtqtfttysdnqpgvliqvye
geramtkdnnllgkfeltgippaprgvpqievtfdidangilnvsavdkstgkenkitit
ndkgrlskediermvqeaekykaedekqrdkvssknsle

SCOP Domain Coordinates for d7hsca_:

Click to download the PDB-style file with coordinates for d7hsca_.
(The format of our PDB-style files is described here.)

Timeline for d7hsca_: