PDB entry 7hsc

View 7hsc on RCSB PDB site
Description: high resolution solution structure of the heat shock cognate-70 kd substrate binding domain obtained by multidimensional nmr techniques
Deposited on 1999-05-03, released 1999-05-10
The last revision prior to the SCOP 1.67 freeze date was dated 1999-05-10, with a file datestamp of 1999-05-09.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d7hsca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7hscA (A:)
  senvqdlllldvtplslgietaggvmtvlikrnttiptkqtqtfttysdnqpgvliqvye
  geramtkdnnllgkfeltgippaprgvpqievtfdidangilnvsavdkstgkenkitit
  ndkgrlskediermvqeaekykaedekqrdkvssknsle