SCOPe 2.01: Domain d1qaib_: 1qai B:

Lineage for d1qaib_ (1qai B:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein MMLV reverse transcriptase [56687] (1 species)

7. Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries)
   Uniprot P03355 RE 144-594

8. Domain d1qaib_: 1qai B: [43020]
   fragment of "palm" and "fingers" domains
   protein/DNA complex; complexed with hg

Details for d1qaib_

PDB Entry: 1qai, 2.3 Å

PDB Description: crystal structures of the n-terminal fragment from moloney murine leukemia virus reverse transcriptase complexed with nucleic acid: functional implications for template-primer binding to the fingers domain

PDB Compounds: (B:) reverse transcriptase

SCOPe Domain Sequences for d1qaib_:

Sequence; same for both SEQRES and ATOM records:

>d1qaib_ e.8.1.2 (B:) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllk

Timeline for d1qaib_:

• d1qaib_ first appeared (with stable ids) in SCOP 1.55
  
• d1qaib_ appears in SCOP 1.75
  
• d1qaib_ appears in SCOPe 2.02
  
• d1qaib_ appears in the current release, SCOPe 2.08