Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
Protein MMLV reverse transcriptase [56687] (1 species) |
Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries) Uniprot P03355 RE 144-594 |
Domain d1qaib_: 1qai B: [43020] fragment of "palm" and "fingers" domains protein/DNA complex; complexed with hg |
PDB Entry: 1qai (more details), 2.3 Å
SCOPe Domain Sequences for d1qaib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qaib_ e.8.1.2 (B:) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq kqvkylgyllk
Timeline for d1qaib_: