Lineage for d1taq_4 (1taq 423-832)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339256Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 339257Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 339258Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 339259Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 339287Species Thermus aquaticus [TaxId:271] [56676] (13 PDB entries)
  8. 339294Domain d1taq_4: 1taq 423-832 [42991]
    Other proteins in same PDB: d1taq_1, d1taq_2, d1taq_3
    complexed with bgl, zn; mutant

Details for d1taq_4

PDB Entry: 1taq (more details), 2.4 Å

PDB Description: structure of taq dna polymerase

SCOP Domain Sequences for d1taq_4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1taq_4 e.8.1.1 (423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlcccdpnlqnipvrtplgqrirrgfiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake

SCOP Domain Coordinates for d1taq_4:

Click to download the PDB-style file with coordinates for d1taq_4.
(The format of our PDB-style files is described here.)

Timeline for d1taq_4: